- Recombinant Rat Transmembrane protein 150C (Tmem150c)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1061008
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 27,815 Da
- E Coli or Yeast
- Transmembrane protein 150C (Tmem150c)
- 1-249
- transmembrane protein 150C
- RGD1306105
Sequence
MDGKKCSVWMFLPLVFTLFTSAGLWIVYFIAVEDDKILPLNSAARKSGVKHAPYISFAGDDPPASCVFSQVMNMAAFLALVVAVLRFIQLKPKVLNPWLNISGLVALCLASFGMTLLGNFQLTNDEEIHNVGTSLTFGFGTLTCWIQAALTLKVNIKNEGRRAGIPRVILSAVITLCVVLYFILMAQDIHMYAARVQWGLVMCFLAYFGTLAVEFRHYRYEIVCSEYQENFLSFSESLSEASEYQTDQV